Product details

IL-1 alpha Antibody

Catalog number KC-828-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-828-01

Size / count 50 μL

Specifications

Catalog number: KC-828-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1
Gene Name: IL1A
Gene ID: 3552
UniProt: P01583
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL1A
Target: PP-064
Partner Proteins: Interleukin-1 alpha; IL-1 alpha; Hematopoietin-1
Clone: K24011_18D3
Conjugation: Unconjugated
Applications: IHC&Top_IP/ChIP&ELISA
Validation: IHC&Top_IP/ChIP&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 59%, Pig - 67%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IL1F1
Target Alternative Name: IL-1 alpha
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Interleukin 1 alpha
WB Description: Fail (THP-1)
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for IL-1 alpha Antibody?

The catalog number for IL-1 alpha Antibody is KC-828.

What sizes are available for IL-1 alpha Antibody?

IL-1 alpha Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL-1 alpha Antibody come in?

IL-1 alpha Antibody is available in 3 different pack sizes.

Is IL-1 alpha Antibody in stock?

IL-1 alpha Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products