Product details

T Box Protein 3 Antibody

Catalog number KC-1696-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1696-01

Size / count 50 μL

Specifications

Catalog number: KC-1696-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-box transcription factor TBX3, T-box protein 3
Gene Name: TBX3
Gene ID: 6926
UniProt: O15119
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TBX3
Target: PP-11042
Partner Proteins: T-box transcription factor TBX3; T-box protein 3
Clone: K24014_12A4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: T Box Protein 3
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: T-box transcription factor 3
WB Description: Succeed
IHC description: Succeed
IP description: Fail (LNCaP clone FGC)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for T Box Protein 3 Antibody?

The catalog number for T Box Protein 3 Antibody is KC-1696.

What sizes are available for T Box Protein 3 Antibody?

T Box Protein 3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Box Protein 3 Antibody come in?

T Box Protein 3 Antibody is available in 3 different pack sizes.

Is T Box Protein 3 Antibody in stock?

T Box Protein 3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.