T Box Protein 3 Antibody

Catalog number KC-810-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-810-01

Size / count 50 μL

Specifications

Catalog number: KC-810-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-box transcription factor TBX3, T-box protein 3
Gene Name: TBX3
Gene ID: 6926
UniProt: O15119
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TBX3
Target: PP-11042
Partner Proteins: T-box transcription factor TBX3; T-box protein 3
Clone: K24014_20C10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: T Box Protein 3
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: T-box transcription factor 3
IHC description: Succeed
IP description: Fail (LNCaP clone FGC)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for T Box Protein 3 Antibody?

The catalog number for T Box Protein 3 Antibody is KC-810.

What sizes are available for T Box Protein 3 Antibody?

T Box Protein 3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Box Protein 3 Antibody come in?

T Box Protein 3 Antibody is available in 3 different pack sizes.

Is T Box Protein 3 Antibody in stock?

T Box Protein 3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.