Fibrinogen gamma Chain Antibody — image 1 of 4

Product details

Fibrinogen gamma Chain Antibody

Catalog number KC-1685-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1685-01

Size / count 50 μL

Specifications

Catalog number: KC-1685-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Fibrinogen gamma chain
Gene Name: FGG
Gene ID: 2266
UniProt: P02679
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FGG
Target: PP-5737
Partner Proteins: Fibrinogen gamma chain
Clone: K24024_2E1
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB&ELISA
Validation: Top_IHC&Top_IP/ChIP&Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 71%, Pig - 75%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
WB Dilution: 1:1000
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Fibrinogen gamma Chain
Host or Source: Mouse
Protein Name: Fibrinogen gamma chain
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Fibrinogen gamma Chain Antibody?

The catalog number for Fibrinogen gamma Chain Antibody is KC-1685.

What sizes are available for Fibrinogen gamma Chain Antibody?

Fibrinogen gamma Chain Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fibrinogen gamma Chain Antibody come in?

Fibrinogen gamma Chain Antibody is available in 3 different pack sizes.

Is Fibrinogen gamma Chain Antibody in stock?

Fibrinogen gamma Chain Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

All Products