Fibrinogen gamma Chain Antibody — image 1 of 4

Product details

Fibrinogen gamma Chain Antibody

Catalog number KC-1686-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1686-01

Size / count 50 μL

Specifications

Catalog number: KC-1686-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Fibrinogen gamma chain
Gene Name: FGG
Gene ID: 2266
UniProt: P02679
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FGG
Target: PP-5737
Partner Proteins: Fibrinogen gamma chain
Clone: K24024_13F12
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB&ELISA
Validation: Top_IHC&Top_IP/ChIP&Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 71%, Pig - 75%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
WB Dilution: 1:1000
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Fibrinogen gamma Chain
Host or Source: Mouse
Protein Name: Fibrinogen gamma chain
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Fibrinogen gamma Chain Antibody?

The catalog number for Fibrinogen gamma Chain Antibody is KC-1686.

What sizes are available for Fibrinogen gamma Chain Antibody?

Fibrinogen gamma Chain Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fibrinogen gamma Chain Antibody come in?

Fibrinogen gamma Chain Antibody is available in 3 different pack sizes.

Is Fibrinogen gamma Chain Antibody in stock?

Fibrinogen gamma Chain Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products