Fibrinogen gamma Chain Antibody

Catalog number KC-1931-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1931-01

Size / count 50 μL

Specifications

Catalog number: KC-1931-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Fibrinogen gamma chain
Gene Name: FGG
Gene ID: 2266
UniProt: P02679
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FGG
Target: PP-5737
Partner Proteins: Fibrinogen gamma chain
Clone: K24024_20D12
Conjugation: Unconjugated
Applications: IHC&Top_WB
Validation: IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 71%, Pig - 75%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Fibrinogen gamma Chain
Host or Source: Mouse
Protein Name: Fibrinogen gamma chain
WB Description: Succeed
IHC description: Succeed
IP description: Fail (Hep G2)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Fibrinogen gamma Chain Antibody?

The catalog number for Fibrinogen gamma Chain Antibody is KC-1931.

What sizes are available for Fibrinogen gamma Chain Antibody?

Fibrinogen gamma Chain Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fibrinogen gamma Chain Antibody come in?

Fibrinogen gamma Chain Antibody is available in 3 different pack sizes.

Is Fibrinogen gamma Chain Antibody in stock?

Fibrinogen gamma Chain Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.