Beta Catenin Antibody

Catalog number KC-3334-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3334-01

Size / count 50 μL

Specifications

Catalog number: KC-3334-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Catenin beta-1, Beta-catenin
Gene Name: CTNNB1
Gene ID: 1499
UniProt: P35222
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human CTNNB1
Target: PP-259
Partner Proteins: Catenin beta-1; Beta-catenin
Clone: K24039_15D5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CTNNB
Target Alternative Name: Beta Catenin
Panel Description: IHC Pathology, Ferroptosis
Host or Source: Mouse
Protein Name: Catenin beta 1
WB Description: Succeed
IHC description: Fail (Colon)
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Beta Catenin Antibody?

The catalog number for Beta Catenin Antibody is KC-3334.

What sizes are available for Beta Catenin Antibody?

Beta Catenin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Beta Catenin Antibody come in?

Beta Catenin Antibody is available in 3 different pack sizes.

Is Beta Catenin Antibody in stock?

Beta Catenin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.