Interferon gamma Antibody — image 1 of 3

Product details

Interferon gamma Antibody

Catalog number KC-201-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-201-01

Size / count 50 μL

Specifications

Catalog number: KC-201-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma, IFN-gamma, Immune interferon
Gene Name: IFNG
Gene ID: 3458
UniProt: P01579
Antigen Species: Human
Reactivity: Human
Cross Reactivity: K29001_1B9 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, CXCL8, IL9, IL10, IL11, IL12, IL13, CSF2, IFNA, CCL2, KITLG and TNF
Immunogen: Recombinant human IFNG
Target: PP-486
Partner Proteins: Interferon gamma; IFN-gamma; Immune interferon
Clone: K29001_1B9
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 40%, Rat - 37%, Pig - 60%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 40%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: Interferon gamma
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Interferon gamma Antibody?

The catalog number for Interferon gamma Antibody is KC-201.

What sizes are available for Interferon gamma Antibody?

Interferon gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Antibody come in?

Interferon gamma Antibody is available in 3 different pack sizes.

Is Interferon gamma Antibody in stock?

Interferon gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

All Products