Interferon gamma Antibody — image 1 of 2

Product details

Interferon gamma Antibody

Catalog number KC-045-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-045-01

Size / count 50 μL

Specifications

Catalog number: KC-045-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma, IFN-gamma, Immune interferon
Gene Name: IFNG
Gene ID: 3458
UniProt: P01579
Antigen Species: Human
Reactivity: Human
Cross Reactivity: K29001_5C7 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, CXCL8, IL9, IL10, IL11, IL12, IL13, CSF2, IFNA, CCL2, KITLG and TNF
Immunogen: Recombinant human IFNG
Target: PP-486
Partner Proteins: Interferon gamma; IFN-gamma; Immune interferon
Clone: K29001_5C7
Conjugation: Unconjugated
Applications: WB&ELISA
Validation: WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 40%, Rat - 37%, Pig - 60%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 40%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: Interferon gamma
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Interferon gamma Antibody?

The catalog number for Interferon gamma Antibody is KC-045.

What sizes are available for Interferon gamma Antibody?

Interferon gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Antibody come in?

Interferon gamma Antibody is available in 3 different pack sizes.

Is Interferon gamma Antibody in stock?

Interferon gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products