Interferon gamma Antibody — image 1 of 2

Product details

Interferon gamma Antibody

Catalog number KC-042-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-042-01

Size / count 50 μL

Specifications

Catalog number: KC-042-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma, IFN-gamma, Immune interferon
Gene Name: IFNG
Gene ID: 3458
UniProt: P01579
Antigen Species: Human
Reactivity: Human
Cross Reactivity: KT219 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, CXCL8, IL9, IL10, IL11, IL12, IL13, CSF2, IFNA, CCL2, KITLG and TNF
Immunogen: Recombinant human IFNG
Target: PP-486
Partner Proteins: Interferon gamma; IFN-gamma; Immune interferon
Clone: KT219
Conjugation: Unconjugated
Applications: WB&ELISA
Validation: WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 40%, Rat - 37%, Pig - 60%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 40%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: Interferon gamma
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Interferon gamma Antibody?

The catalog number for Interferon gamma Antibody is KC-042.

What sizes are available for Interferon gamma Antibody?

Interferon gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Antibody come in?

Interferon gamma Antibody is available in 3 different pack sizes.

Is Interferon gamma Antibody in stock?

Interferon gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products