Interferon gamma Antibody — image 1 of 3

Product details

Interferon gamma Antibody

Catalog number KC-046-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-046-01

Size / count 50 μL

Specifications

Catalog number: KC-046-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon gamma, IFN-gamma, Immune interferon
Gene Name: IFNG
Gene ID: 3458
UniProt: P01579
Antigen Species: Human
Reactivity: Human
Cross Reactivity: K29001_11F4 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, CXCL8, IL9, IL10, IL11, IL12, IL13, CSF2, IFNA, CCL2, KITLG and TNF
Immunogen: Recombinant human IFNG
Target: PP-486
Partner Proteins: Interferon gamma; IFN-gamma; Immune interferon
Clone: K29001_11F4
Conjugation: Unconjugated
Applications: WB&ELISA
Validation: WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 40%, Rat - 37%, Pig - 60%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 40%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Interferon gamma
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: Interferon gamma
WB Description: Succeed
IHC description: Fail (Kidney)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Interferon gamma Antibody?

The catalog number for Interferon gamma Antibody is KC-046.

What sizes are available for Interferon gamma Antibody?

Interferon gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Interferon gamma Antibody come in?

Interferon gamma Antibody is available in 3 different pack sizes.

Is Interferon gamma Antibody in stock?

Interferon gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.