MMP1 Antibody (HRP)

Catalog number KH-3195-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3195-01

Size / count 50 μL

Specifications

Catalog number: KH-3195-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interstitial collagenase, Fibroblast collagenase, Matrix metalloproteinase-1, MMP-1) [Cleaved into: 22 kDa interstitial collagenase, 27 kDa interstitial collagenase]
Gene Name: MMP1
Gene ID: 4312
UniProt: P03956
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MMP1
Target: PP-076
Partner Proteins: Interstitial collagenase; Fibroblast collagenase; Matrix metalloproteinase-1; MMP-1) [Cleaved into: 22 kDa interstitial collagenase; 27 kDa interstitial collagenase]
Clone: K29028_8G2
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 66%, Rat - 64%, Pig - 90%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: QTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 66%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CLG
Target Alternative Name: MMP1
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Matrix metallopeptidase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for MMP1 Antibody (HRP)?

The catalog number for MMP1 Antibody (HRP) is KH-3195.

What sizes are available for MMP1 Antibody (HRP)?

MMP1 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MMP1 Antibody (HRP) come in?

MMP1 Antibody (HRP) is available in 3 different pack sizes.

Is MMP1 Antibody (HRP) in stock?

MMP1 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.