Product details

Cathepsin S Antibody

Catalog number KC-1120-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1120-01

Size / count 50 μL

Specifications

Catalog number: KC-1120-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cathepsin S
Gene Name: CTSS
Gene ID: 1520
UniProt: P25774
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CTSS
Target: PP-1683
Partner Proteins: Cathepsin S
Clone: K29028_13C4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Cathepsin S
Host or Source: Mouse
Protein Name: Cathepsin S
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Cathepsin S Antibody?

The catalog number for Cathepsin S Antibody is KC-1120.

What sizes are available for Cathepsin S Antibody?

Cathepsin S Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cathepsin S Antibody come in?

Cathepsin S Antibody is available in 3 different pack sizes.

Is Cathepsin S Antibody in stock?

Cathepsin S Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.