Product details

Cathepsin S Antibody

Catalog number KC-1022-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1022-01

Size / count 50 μL

Specifications

Catalog number: KC-1022-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cathepsin S
Gene Name: CTSS
Gene ID: 1520
UniProt: P25774
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CTSS
Target: PP-1683
Partner Proteins: Cathepsin S
Clone: K29028_14G7
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Cathepsin S
Host or Source: Mouse
Protein Name: Cathepsin S
WB Description: Succeed
IP description: Fail (HL-60)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Cathepsin S Antibody?

The catalog number for Cathepsin S Antibody is KC-1022.

What sizes are available for Cathepsin S Antibody?

Cathepsin S Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cathepsin S Antibody come in?

Cathepsin S Antibody is available in 3 different pack sizes.

Is Cathepsin S Antibody in stock?

Cathepsin S Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.