Fructose 6 Phosphate Kinase Antibody

Catalog number KC-2190-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2190-01

Size / count 50 μL

Specifications

Catalog number: KC-2190-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: ATP-dependent 6-phosphofructokinase, muscle type, ATP-PFK, PFK-M, 6-phosphofructokinase type A, Phosphofructo-1-kinase isozyme A, PFK-A, Phosphohexokinase
Gene Name: PFKM
Gene ID: 5213
UniProt: P08237
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PFKM
Target: PP-1442
Partner Proteins: ATP-dependent 6-phosphofructokinase; muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase
Clone: K29051_5E5
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 93%, Pig - 94%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PFKX
Target Alternative Name: Fructose 6 Phosphate Kinase
Host or Source: Mouse
Protein Name: Phosphofructokinase, muscle
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Fructose 6 Phosphate Kinase Antibody?

The catalog number for Fructose 6 Phosphate Kinase Antibody is KC-2190.

What sizes are available for Fructose 6 Phosphate Kinase Antibody?

Fructose 6 Phosphate Kinase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fructose 6 Phosphate Kinase Antibody come in?

Fructose 6 Phosphate Kinase Antibody is available in 3 different pack sizes.

Is Fructose 6 Phosphate Kinase Antibody in stock?

Fructose 6 Phosphate Kinase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

All Products