Fructose 6 Phosphate Kinase Antibody — image 1 of 3

Product details

Fructose 6 Phosphate Kinase Antibody

Catalog number KC-1965-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1965-01

Size / count 50 μL

Specifications

Catalog number: KC-1965-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: ATP-dependent 6-phosphofructokinase, muscle type, ATP-PFK, PFK-M, 6-phosphofructokinase type A, Phosphofructo-1-kinase isozyme A, PFK-A, Phosphohexokinase
Gene Name: PFKM
Gene ID: 5213
UniProt: P08237
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PFKM
Target: PP-1442
Partner Proteins: ATP-dependent 6-phosphofructokinase; muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase
Clone: K29051_15A5
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB
Validation: Top_IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 93%, Pig - 94%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PFKX
Target Alternative Name: Fructose 6 Phosphate Kinase
Host or Source: Mouse
Protein Name: Phosphofructokinase, muscle
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Fructose 6 Phosphate Kinase Antibody?

The catalog number for Fructose 6 Phosphate Kinase Antibody is KC-1965.

What sizes are available for Fructose 6 Phosphate Kinase Antibody?

Fructose 6 Phosphate Kinase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fructose 6 Phosphate Kinase Antibody come in?

Fructose 6 Phosphate Kinase Antibody is available in 3 different pack sizes.

Is Fructose 6 Phosphate Kinase Antibody in stock?

Fructose 6 Phosphate Kinase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

All Products