Fructose 6 Phosphate Kinase Antibody

Catalog number KC-2096-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2096-01

Size / count 50 μL

Specifications

Catalog number: KC-2096-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: ATP-dependent 6-phosphofructokinase, muscle type, ATP-PFK, PFK-M, 6-phosphofructokinase type A, Phosphofructo-1-kinase isozyme A, PFK-A, Phosphohexokinase
Gene Name: PFKM
Gene ID: 5213
UniProt: P08237
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PFKM
Target: PP-1442
Partner Proteins: ATP-dependent 6-phosphofructokinase; muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase
Clone: K29051_16C1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 93%, Pig - 94%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PFKX
Target Alternative Name: Fructose 6 Phosphate Kinase
Host or Source: Mouse
Protein Name: Phosphofructokinase, muscle
IHC description: Succeed
IP description: Fail (SH-SY5Y)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Fructose 6 Phosphate Kinase Antibody?

The catalog number for Fructose 6 Phosphate Kinase Antibody is KC-2096.

What sizes are available for Fructose 6 Phosphate Kinase Antibody?

Fructose 6 Phosphate Kinase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fructose 6 Phosphate Kinase Antibody come in?

Fructose 6 Phosphate Kinase Antibody is available in 3 different pack sizes.

Is Fructose 6 Phosphate Kinase Antibody in stock?

Fructose 6 Phosphate Kinase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.