Prostate Secretory Protein Antibody

Catalog number KC-2500-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2500-01

Size / count 50 μL

Specifications

Catalog number: KC-2500-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Beta-microseminoprotein, Immunoglobulin-binding factor, IGBF, PN44, Prostate secreted seminal plasma protein, Prostate secretory protein of 94 amino acids, PSP-94, PSP94, Seminal plasma beta-inhibin
Gene Name: MSMB
Gene ID: 4477
UniProt: P08118
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MSMB
Target: PP-1091
Partner Proteins: Beta-microseminoprotein; Immunoglobulin-binding factor; IGBF; PN44; Prostate secreted seminal plasma protein; Prostate secretory protein of 94 amino acids; PSP-94; PSP94; Seminal plasma beta-inhibin
Clone: K29052_4A1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 48%, Rat - 49%, Pig - 53%, Cynomolgus monkey - 83%
Purity: ≥85%
Cores: PGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 48%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PRSP
Target Alternative Name: Prostate Secretory Protein
Host or Source: Mouse
Protein Name: Microseminoprotein beta
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Prostate Secretory Protein Antibody?

The catalog number for Prostate Secretory Protein Antibody is KC-2500.

What sizes are available for Prostate Secretory Protein Antibody?

Prostate Secretory Protein Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Prostate Secretory Protein Antibody come in?

Prostate Secretory Protein Antibody is available in 3 different pack sizes.

Is Prostate Secretory Protein Antibody in stock?

Prostate Secretory Protein Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products