Angiopoietin-2 Antibody

Catalog number KC-2288-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2288-01

Size / count 50 μL

Specifications

Catalog number: KC-2288-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Angiopoietin-2, ANG-2
Gene Name: ANGPT2
Gene ID: 285
UniProt: O15123
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANGPT2
Target: PQ-049
Partner Proteins: Angiopoietin-2; ANG-2
Clone: K29054_15E2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 94%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: LEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Angiopoietin-2
Host or Source: Mouse
Protein Name: Angiopoietin 2
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Angiopoietin-2 Antibody?

The catalog number for Angiopoietin-2 Antibody is KC-2288.

What sizes are available for Angiopoietin-2 Antibody?

Angiopoietin-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Angiopoietin-2 Antibody come in?

Angiopoietin-2 Antibody is available in 3 different pack sizes.

Is Angiopoietin-2 Antibody in stock?

Angiopoietin-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

All Products