CXCL6 Antibody (HRP)

Catalog number KH-2840-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2840-01

Size / count 50 μL

Specifications

Catalog number: KH-2840-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-X-C motif chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte chemotactic protein 2, GCP-2, Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6, N-processed variant 1, Small-inducible cytokine B6, N-processed variant 2, Small-inducible cytokine B6, N-processed variant 3]
Gene Name: CXCL6
Gene ID: 6372
UniProt: P80162
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL6
Target: PQ-267
Partner Proteins: C-X-C motif chemokine 6; Chemokine alpha 3; CKA-3; Granulocyte chemotactic protein 2; GCP-2; Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6; N-processed variant 1; Small-inducible cytokine B6; N-processed variant 2; Small-inducible cytokine B6; N-processed variant 3]
Clone: K29056_7D12
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 68%, Rat - 65%, Pig - 66%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 68%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GCP2; SCYB6
Target Alternative Name: CXCL6
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 6
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CXCL6 Antibody (HRP)?

The catalog number for CXCL6 Antibody (HRP) is KH-2840.

What sizes are available for CXCL6 Antibody (HRP)?

CXCL6 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CXCL6 Antibody (HRP) come in?

CXCL6 Antibody (HRP) is available in 3 different pack sizes.

Is CXCL6 Antibody (HRP) in stock?

CXCL6 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products