Tryptophanyl tRNA synthetase/WRS Antibody

Catalog number KC-2951-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2951-01

Size / count 50 μL

Specifications

Catalog number: KC-2951-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tryptophan--tRNA ligase, cytoplasmic, Interferon-induced protein 53, IFP53, Tryptophanyl-tRNA synthetase, TrpRS, hWRS) [Cleaved into: T1-TrpRS, T2-TrpRS]
Gene Name: WARS1
Gene ID: 7453
UniProt: P23381
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WARS1
Target: PP-1379
Partner Proteins: Tryptophan--tRNA ligase; cytoplasmic; Interferon-induced protein 53; IFP53; Tryptophanyl-tRNA synthetase; TrpRS; hWRS) [Cleaved into: T1-TrpRS; T2-TrpRS]
Clone: K29059_11F4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: ELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 86%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IFI53; WARS; WRS
Target Alternative Name: Tryptophanyl tRNA synthetase/WRS
Host or Source: Mouse
Protein Name: Tryptophanyl-tRNA synthetase 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Tryptophanyl tRNA synthetase/WRS Antibody?

The catalog number for Tryptophanyl tRNA synthetase/WRS Antibody is KC-2951.

What sizes are available for Tryptophanyl tRNA synthetase/WRS Antibody?

Tryptophanyl tRNA synthetase/WRS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tryptophanyl tRNA synthetase/WRS Antibody come in?

Tryptophanyl tRNA synthetase/WRS Antibody is available in 3 different pack sizes.

Is Tryptophanyl tRNA synthetase/WRS Antibody in stock?

Tryptophanyl tRNA synthetase/WRS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.