Tryptophanyl tRNA synthetase/WRS Antibody

Catalog number KC-3023-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3023-01

Size / count 50 μL

Specifications

Catalog number: KC-3023-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tryptophan--tRNA ligase, cytoplasmic, Interferon-induced protein 53, IFP53, Tryptophanyl-tRNA synthetase, TrpRS, hWRS) [Cleaved into: T1-TrpRS, T2-TrpRS]
Gene Name: WARS1
Gene ID: 7453
UniProt: P23381
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WARS1
Target: PP-1379
Partner Proteins: Tryptophan--tRNA ligase; cytoplasmic; Interferon-induced protein 53; IFP53; Tryptophanyl-tRNA synthetase; TrpRS; hWRS) [Cleaved into: T1-TrpRS; T2-TrpRS]
Clone: K29059_17E4
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: ELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 86%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IFI53; WARS; WRS
Target Alternative Name: Tryptophanyl tRNA synthetase/WRS
Host or Source: Mouse
Protein Name: Tryptophanyl-tRNA synthetase 1
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Tryptophanyl tRNA synthetase/WRS Antibody?

The catalog number for Tryptophanyl tRNA synthetase/WRS Antibody is KC-3023.

What sizes are available for Tryptophanyl tRNA synthetase/WRS Antibody?

Tryptophanyl tRNA synthetase/WRS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tryptophanyl tRNA synthetase/WRS Antibody come in?

Tryptophanyl tRNA synthetase/WRS Antibody is available in 3 different pack sizes.

Is Tryptophanyl tRNA synthetase/WRS Antibody in stock?

Tryptophanyl tRNA synthetase/WRS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products