Product details

AMPK alpha 1 Antibody

Catalog number KC-3132-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3132-01

Size / count 50 μL

Specifications

Catalog number: KC-3132-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK subunit alpha-1, Acetyl-CoA carboxylase kinase, ACACA kinase, Hydroxymethylglutaryl-CoA reductase kinase, HMGCR kinase, Tau-protein kinase PRKAA1
Gene Name: PRKAA1
Gene ID: 5562
UniProt: Q13131
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKAA1
Target: PP-1416
Partner Proteins: 5'-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; Acetyl-CoA carboxylase kinase; ACACA kinase; Hydroxymethylglutaryl-CoA reductase kinase; HMGCR kinase; Tau-protein kinase PRKAA1
Clone: K29067_16D2
Conjugation: Unconjugated
Applications: Top_IHC&IP/ChIP
Validation: Top_IHC&IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AMPK1
Target Alternative Name: AMPK alpha 1
Panel Description: DNA binding & Chromatin, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase AMP-activated catalytic subunit alpha 1
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for AMPK alpha 1 Antibody?

The catalog number for AMPK alpha 1 Antibody is KC-3132.

What sizes are available for AMPK alpha 1 Antibody?

AMPK alpha 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does AMPK alpha 1 Antibody come in?

AMPK alpha 1 Antibody is available in 3 different pack sizes.

Is AMPK alpha 1 Antibody in stock?

AMPK alpha 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products