Chromogranin-A Antibody

Catalog number KC-216-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-216-01

Size / count 50 μL

Specifications

Catalog number: KC-216-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Chromogranin-A, CgA, Pituitary secretory protein I, SP-I) [Cleaved into: Vasostatin-1, Vasostatin I, Vasostatin-2, Vasostatin II, EA-92, ES-43, Pancreastatin, SS-18, WA-8, WE-14, LF-19, Catestatin, SL21, AL-11, GV-19, GR-44, ER-37, GE-25, Serpinin-RRG, Serpinin, p-Glu serpinin precursor]
Gene Name: CHGA
Gene ID: 1113
UniProt: P10645
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHGA
Target: PP-153
Partner Proteins: Chromogranin-A; CgA; Pituitary secretory protein I; SP-I) [Cleaved into: Vasostatin-1; Vasostatin I; Vasostatin-2; Vasostatin II; EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin; SL21; AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor]
Clone: K40019_2H2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 84%, Pig - 86%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Chromogranin-A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Chromogranin A
WB Description: Fail (Purification of Antigens)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Chromogranin-A Antibody?

The catalog number for Chromogranin-A Antibody is KC-216.

What sizes are available for Chromogranin-A Antibody?

Chromogranin-A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Chromogranin-A Antibody come in?

Chromogranin-A Antibody is available in 3 different pack sizes.

Is Chromogranin-A Antibody in stock?

Chromogranin-A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.