Chromogranin-A Antibody

Catalog number KC-1508-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1508-01

Size / count 50 μL

Specifications

Catalog number: KC-1508-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Chromogranin-A, CgA, Pituitary secretory protein I, SP-I) [Cleaved into: Vasostatin-1, Vasostatin I, Vasostatin-2, Vasostatin II, EA-92, ES-43, Pancreastatin, SS-18, WA-8, WE-14, LF-19, Catestatin, SL21, AL-11, GV-19, GR-44, ER-37, GE-25, Serpinin-RRG, Serpinin, p-Glu serpinin precursor]
Gene Name: CHGA
Gene ID: 1113
UniProt: P10645
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHGA
Target: PP-153
Partner Proteins: Chromogranin-A; CgA; Pituitary secretory protein I; SP-I) [Cleaved into: Vasostatin-1; Vasostatin I; Vasostatin-2; Vasostatin II; EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin; SL21; AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor]
Clone: K40019_5F7
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 84%, Pig - 86%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Chromogranin-A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Chromogranin A
WB Description: Fail (Purification of Antigens)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Chromogranin-A Antibody?

The catalog number for Chromogranin-A Antibody is KC-1508.

What sizes are available for Chromogranin-A Antibody?

Chromogranin-A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Chromogranin-A Antibody come in?

Chromogranin-A Antibody is available in 3 different pack sizes.

Is Chromogranin-A Antibody in stock?

Chromogranin-A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products