Chromogranin-A Antibody

Catalog number KC-1507-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1507-01

Size / count 50 μL

Specifications

Catalog number: KC-1507-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Chromogranin-A, CgA, Pituitary secretory protein I, SP-I) [Cleaved into: Vasostatin-1, Vasostatin I, Vasostatin-2, Vasostatin II, EA-92, ES-43, Pancreastatin, SS-18, WA-8, WE-14, LF-19, Catestatin, SL21, AL-11, GV-19, GR-44, ER-37, GE-25, Serpinin-RRG, Serpinin, p-Glu serpinin precursor]
Gene Name: CHGA
Gene ID: 1113
UniProt: P10645
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHGA
Target: PP-153
Partner Proteins: Chromogranin-A; CgA; Pituitary secretory protein I; SP-I) [Cleaved into: Vasostatin-1; Vasostatin I; Vasostatin-2; Vasostatin II; EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin; SL21; AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor]
Clone: K40019_6A2
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 84%, Pig - 86%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Chromogranin-A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Chromogranin A
WB Description: Fail (Purification of Antigens)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Chromogranin-A Antibody?

The catalog number for Chromogranin-A Antibody is KC-1507.

What sizes are available for Chromogranin-A Antibody?

Chromogranin-A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Chromogranin-A Antibody come in?

Chromogranin-A Antibody is available in 3 different pack sizes.

Is Chromogranin-A Antibody in stock?

Chromogranin-A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.