Chromogranin-A Antibody

Catalog number KC-218-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-218-01

Size / count 50 μL

Specifications

Catalog number: KC-218-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Chromogranin-A, CgA, Pituitary secretory protein I, SP-I) [Cleaved into: Vasostatin-1, Vasostatin I, Vasostatin-2, Vasostatin II, EA-92, ES-43, Pancreastatin, SS-18, WA-8, WE-14, LF-19, Catestatin, SL21, AL-11, GV-19, GR-44, ER-37, GE-25, Serpinin-RRG, Serpinin, p-Glu serpinin precursor]
Gene Name: CHGA
Gene ID: 1113
UniProt: P10645
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHGA
Target: PP-153
Partner Proteins: Chromogranin-A; CgA; Pituitary secretory protein I; SP-I) [Cleaved into: Vasostatin-1; Vasostatin I; Vasostatin-2; Vasostatin II; EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin; SL21; AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor]
Clone: K40019_6F2
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 84%, Pig - 86%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Chromogranin-A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Chromogranin A
WB Description: Fail (Purification of Antigens)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Chromogranin-A Antibody?

The catalog number for Chromogranin-A Antibody is KC-218.

What sizes are available for Chromogranin-A Antibody?

Chromogranin-A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Chromogranin-A Antibody come in?

Chromogranin-A Antibody is available in 3 different pack sizes.

Is Chromogranin-A Antibody in stock?

Chromogranin-A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.