Anti-Human Lambda Antibody

Catalog number KC-1650-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1650-01

Size / count 50 μL

Specifications

Catalog number: KC-1650-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin lambda constant 2, Ig lambda chain C region Kern, Ig lambda chain C region NIG-64, Ig lambda chain C region SH, Ig lambda chain C region X, Ig lambda-2 chain C region
Gene Name: IGLC2
Gene ID: 3538
UniProt: P0DOY2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IGLC2
Target: PP-3217
Partner Proteins: Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region
Clone: K40033_4A4
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 71%, Rat - 67%, Pig - 74%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 71%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human Lambda
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin lambda constant 2
WB Description: Succeed
IP description: Fail (Plasma (SH191-200P) )
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-Human Lambda Antibody?

The catalog number for Anti-Human Lambda Antibody is KC-1650.

What sizes are available for Anti-Human Lambda Antibody?

Anti-Human Lambda Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human Lambda Antibody come in?

Anti-Human Lambda Antibody is available in 3 different pack sizes.

Is Anti-Human Lambda Antibody in stock?

Anti-Human Lambda Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products