Anti-Human Lambda Antibody

Catalog number KC-1783-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1783-01

Size / count 50 μL

Specifications

Catalog number: KC-1783-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin lambda constant 2, Ig lambda chain C region Kern, Ig lambda chain C region NIG-64, Ig lambda chain C region SH, Ig lambda chain C region X, Ig lambda-2 chain C region
Gene Name: IGLC2
Gene ID: 3538
UniProt: P0DOY2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IGLC2
Target: PP-3217
Partner Proteins: Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region
Clone: K40033_4F3
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 71%, Rat - 67%, Pig - 74%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 71%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human Lambda
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin lambda constant 2
WB Description: Succeed
IP description: Fail (Plasma (SH-227P) )
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Anti-Human Lambda Antibody?

The catalog number for Anti-Human Lambda Antibody is KC-1783.

What sizes are available for Anti-Human Lambda Antibody?

Anti-Human Lambda Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human Lambda Antibody come in?

Anti-Human Lambda Antibody is available in 3 different pack sizes.

Is Anti-Human Lambda Antibody in stock?

Anti-Human Lambda Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.