Anti-Human Lambda Antibody

Catalog number KC-1651-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1651-01

Size / count 50 μL

Specifications

Catalog number: KC-1651-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin lambda constant 2, Ig lambda chain C region Kern, Ig lambda chain C region NIG-64, Ig lambda chain C region SH, Ig lambda chain C region X, Ig lambda-2 chain C region
Gene Name: IGLC2
Gene ID: 3538
UniProt: P0DOY2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IGLC2
Target: PP-3217
Partner Proteins: Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region
Clone: K40033_10A2
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 71%, Rat - 67%, Pig - 74%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 71%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human Lambda
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin lambda constant 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Anti-Human Lambda Antibody?

The catalog number for Anti-Human Lambda Antibody is KC-1651.

What sizes are available for Anti-Human Lambda Antibody?

Anti-Human Lambda Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human Lambda Antibody come in?

Anti-Human Lambda Antibody is available in 3 different pack sizes.

Is Anti-Human Lambda Antibody in stock?

Anti-Human Lambda Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.