Product details

NF-KB p105 Antibody

Catalog number KC-2046-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2046-01

Size / count 50 μL

Specifications

Catalog number: KC-2046-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Nuclear factor NF-kappa-B p105 subunit, DNA-binding factor KBF1, EBP-1, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit]
Gene Name: NFKB1
Gene ID: 4790
UniProt: P19838
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NFKB1
Target: PP-571
Partner Proteins: Nuclear factor NF-kappa-B p105 subunit; DNA-binding factor KBF1; EBP-1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit]
Clone: K40035_2B11
Conjugation: Unconjugated
Applications: Top_IHC&IP/ChIP
Validation: Top_IHC&IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 71%, Rat - 68%, Pig - 83%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: KDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 71%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: NF-KB p105
Panel Description: Neuroscience Biomarkers, Transcription Factors
Host or Source: Mouse
Protein Name: Nuclear factor kappa B subunit 1
WB Description: Fail (Core Solo cell Leukemia)
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for NF-KB p105 Antibody?

The catalog number for NF-KB p105 Antibody is KC-2046.

What sizes are available for NF-KB p105 Antibody?

NF-KB p105 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NF-KB p105 Antibody come in?

NF-KB p105 Antibody is available in 3 different pack sizes.

Is NF-KB p105 Antibody in stock?

NF-KB p105 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.