T Cell Leukemia/Lymphoma Protein 1A Antibody

Catalog number KC-1246-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1246-01

Size / count 50 μL

Specifications

Catalog number: KC-1246-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell leukemia/lymphoma protein 1A, Oncogene TCL-1, Oncogene TCL1, Protein p14 TCL1
Gene Name: TCL1A
Gene ID: 8115
UniProt: P56279
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TCL1A
Target: PP-3438
Partner Proteins: T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Clone: K40047_5A7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Pig - 56%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TCL1
Target Alternative Name: T Cell Leukemia/Lymphoma Protein 1A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: TCL1 family AKT coactivator A
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody?

The catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody is KC-1246.

What sizes are available for T Cell Leukemia/Lymphoma Protein 1A Antibody?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Cell Leukemia/Lymphoma Protein 1A Antibody come in?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in 3 different pack sizes.

Is T Cell Leukemia/Lymphoma Protein 1A Antibody in stock?

T Cell Leukemia/Lymphoma Protein 1A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

All Products