T Cell Leukemia/Lymphoma Protein 1A Antibody — image 1 of 2

Product details

T Cell Leukemia/Lymphoma Protein 1A Antibody

Catalog number KC-1129-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1129-01

Size / count 50 μL

Specifications

Catalog number: KC-1129-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell leukemia/lymphoma protein 1A, Oncogene TCL-1, Oncogene TCL1, Protein p14 TCL1
Gene Name: TCL1A
Gene ID: 8115
UniProt: P56279
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TCL1A
Target: PP-3438
Partner Proteins: T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Clone: K40047_6C1
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB
Validation: Top_IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Pig - 56%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TCL1
Target Alternative Name: T Cell Leukemia/Lymphoma Protein 1A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: TCL1 family AKT coactivator A
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody?

The catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody is KC-1129.

What sizes are available for T Cell Leukemia/Lymphoma Protein 1A Antibody?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Cell Leukemia/Lymphoma Protein 1A Antibody come in?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in 3 different pack sizes.

Is T Cell Leukemia/Lymphoma Protein 1A Antibody in stock?

T Cell Leukemia/Lymphoma Protein 1A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.