T Cell Leukemia/Lymphoma Protein 1A Antibody

Catalog number KC-1131-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1131-01

Size / count 50 μL

Specifications

Catalog number: KC-1131-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell leukemia/lymphoma protein 1A, Oncogene TCL-1, Oncogene TCL1, Protein p14 TCL1
Gene Name: TCL1A
Gene ID: 8115
UniProt: P56279
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TCL1A
Target: PP-3438
Partner Proteins: T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Clone: K40047_7D6
Conjugation: Unconjugated
Applications: IHC&Top_IP/ChIP
Validation: IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Pig - 56%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TCL1
Target Alternative Name: T Cell Leukemia/Lymphoma Protein 1A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: TCL1 family AKT coactivator A
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody?

The catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody is KC-1131.

What sizes are available for T Cell Leukemia/Lymphoma Protein 1A Antibody?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Cell Leukemia/Lymphoma Protein 1A Antibody come in?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in 3 different pack sizes.

Is T Cell Leukemia/Lymphoma Protein 1A Antibody in stock?

T Cell Leukemia/Lymphoma Protein 1A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.