T Cell Leukemia/Lymphoma Protein 1A Antibody — image 1 of 2

Product details

T Cell Leukemia/Lymphoma Protein 1A Antibody

Catalog number KC-1130-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1130-01

Size / count 50 μL

Specifications

Catalog number: KC-1130-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell leukemia/lymphoma protein 1A, Oncogene TCL-1, Oncogene TCL1, Protein p14 TCL1
Gene Name: TCL1A
Gene ID: 8115
UniProt: P56279
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TCL1A
Target: PP-3438
Partner Proteins: T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Clone: K40047_8H9
Conjugation: Unconjugated
Applications: IHC&Top_IP/ChIP&Top_WB
Validation: IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Pig - 56%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TCL1
Target Alternative Name: T Cell Leukemia/Lymphoma Protein 1A
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: TCL1 family AKT coactivator A
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody?

The catalog number for T Cell Leukemia/Lymphoma Protein 1A Antibody is KC-1130.

What sizes are available for T Cell Leukemia/Lymphoma Protein 1A Antibody?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does T Cell Leukemia/Lymphoma Protein 1A Antibody come in?

T Cell Leukemia/Lymphoma Protein 1A Antibody is available in 3 different pack sizes.

Is T Cell Leukemia/Lymphoma Protein 1A Antibody in stock?

T Cell Leukemia/Lymphoma Protein 1A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products