PKC-beta 1 Antibody

Catalog number KC-1421-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1421-01

Size / count 50 μL

Specifications

Catalog number: KC-1421-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C beta type, PKC-B, PKC-beta
Gene Name: PRKCB
Gene ID: 5579
UniProt: P05771
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKCB
Target: PP-10655
Partner Proteins: Protein kinase C beta type; PKC-B; PKC-beta
Clone: K40051_19A12
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PKCB; PRKCB1
Target Alternative Name: PKC-beta 1
Panel Description: DNA binding & Chromatin, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase C beta
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for PKC-beta 1 Antibody?

The catalog number for PKC-beta 1 Antibody is KC-1421.

What sizes are available for PKC-beta 1 Antibody?

PKC-beta 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PKC-beta 1 Antibody come in?

PKC-beta 1 Antibody is available in 3 different pack sizes.

Is PKC-beta 1 Antibody in stock?

PKC-beta 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

All Products