Gamma Sarcoglycan Antibody — image 1 of 2

Product details

Gamma Sarcoglycan Antibody

Catalog number KC-2563-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2563-01

Size / count 50 μL

Specifications

Catalog number: KC-2563-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Gamma-synuclein, Breast cancer-specific gene 1 protein, Persyn, Synoretin, SR
Gene Name: SNCG
Gene ID: 6623
UniProt: O76070
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SNCG
Target: PP-037
Partner Proteins: Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR
Clone: K40066_17D1
Conjugation: Unconjugated
Applications: IHC&ICC/IF
Validation: IHC&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 89%, Pig - 90%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:250~1:500
IF Dilution: 1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BCSG1; PERSYN; PRSN
Target Alternative Name: Gamma Synuclein/SNCG
Host or Source: Mouse
Protein Name: Synuclein gamma
IHC description: Succeed
IF/ICC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Gamma Sarcoglycan Antibody?

The catalog number for Gamma Sarcoglycan Antibody is KC-2563.

What sizes are available for Gamma Sarcoglycan Antibody?

Gamma Sarcoglycan Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Gamma Sarcoglycan Antibody come in?

Gamma Sarcoglycan Antibody is available in 3 different pack sizes.

Is Gamma Sarcoglycan Antibody in stock?

Gamma Sarcoglycan Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products