PKA RI alpha Antibody

Catalog number KC-2948-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2948-01

Size / count 50 μL

Specifications

Catalog number: KC-2948-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CAMP-dependent protein kinase type I-alpha regulatory subunit, Tissue-specific extinguisher 1, TSE1
Gene Name: PRKAR1A
Gene ID: 5573
UniProt: P10644
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKAR1A
Target: PP-739
Partner Proteins: CAMP-dependent protein kinase type I-alpha regulatory subunit; Tissue-specific extinguisher 1; TSE1
Clone: K40070_14G9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: DAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PKR1; PRKAR1; TSE1
Target Alternative Name: PKA RI alpha
Host or Source: Mouse
Protein Name: Protein kinase cAMP-dependent type I regulatory subunit alpha
WB Description: Fail (HeLa)
IHC description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PKA RI alpha Antibody?

The catalog number for PKA RI alpha Antibody is KC-2948.

What sizes are available for PKA RI alpha Antibody?

PKA RI alpha Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PKA RI alpha Antibody come in?

PKA RI alpha Antibody is available in 3 different pack sizes.

Is PKA RI alpha Antibody in stock?

PKA RI alpha Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products