ANKRD26P1 Antibody

Catalog number KC-2953-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2953-01

Size / count 50 μL

Specifications

Catalog number: KC-2953-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative ankyrin repeat domain-containing protein 26-like protein
Gene Name: ANKRD26P1
Gene ID: 124149
UniProt: Q6NSI1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANKRD26P1
Target: PP-9868
Partner Proteins: Putative ankyrin repeat domain-containing protein 26-like protein
Clone: K40073_16H6
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 39%, Pig - 46%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: HHANIESANKDELTPFLLAVHEQKQQMEDFLRKQKENLTAVKLESIHQVMSEYKENETPRNPQNSNPEGTSNKMACLGEGAAGAKVDEIPGNPVKRLFNKPSIDDSRPMSANEDFDFDTEEKATEPANGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 39%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ANKRD26P1
Host or Source: Mouse
Protein Name: Ankyrin repeat domain 26 pseudogene 1
IHC description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ANKRD26P1 Antibody?

The catalog number for ANKRD26P1 Antibody is KC-2953.

What sizes are available for ANKRD26P1 Antibody?

ANKRD26P1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ANKRD26P1 Antibody come in?

ANKRD26P1 Antibody is available in 3 different pack sizes.

Is ANKRD26P1 Antibody in stock?

ANKRD26P1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.