Adenosine Deaminase Antibody — image 1 of 2

Product details

Adenosine Deaminase Antibody

Catalog number KC-3184-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3184-01

Size / count 50 μL

Specifications

Catalog number: KC-3184-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Adenosine deaminase, Adenosine aminohydrolase
Gene Name: ADA
Gene ID: 100
UniProt: P00813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADA
Target: PP-1636
Partner Proteins: Adenosine deaminase; Adenosine aminohydrolase
Clone: K40075_1D5
Conjugation: Unconjugated
Applications: Top_IP/ChIP&ELISA
Validation: Top_IP/ChIP&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ADA1
Target Alternative Name: Adenosine Deaminase
Host or Source: Mouse
Protein Name: Adenosine deaminase
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Adenosine Deaminase Antibody?

The catalog number for Adenosine Deaminase Antibody is KC-3184.

What sizes are available for Adenosine Deaminase Antibody?

Adenosine Deaminase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Adenosine Deaminase Antibody come in?

Adenosine Deaminase Antibody is available in 3 different pack sizes.

Is Adenosine Deaminase Antibody in stock?

Adenosine Deaminase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products