Adenosine Deaminase Antibody — image 1 of 2

Product details

Adenosine Deaminase Antibody

Catalog number KC-3206-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3206-01

Size / count 50 μL

Specifications

Catalog number: KC-3206-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Adenosine deaminase, Adenosine aminohydrolase
Gene Name: ADA
Gene ID: 100
UniProt: P00813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADA
Target: PP-1636
Partner Proteins: Adenosine deaminase; Adenosine aminohydrolase
Clone: K40075_10G11
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ADA1
Target Alternative Name: Adenosine Deaminase
Host or Source: Mouse
Protein Name: Adenosine deaminase
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Adenosine Deaminase Antibody?

The catalog number for Adenosine Deaminase Antibody is KC-3206.

What sizes are available for Adenosine Deaminase Antibody?

Adenosine Deaminase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Adenosine Deaminase Antibody come in?

Adenosine Deaminase Antibody is available in 3 different pack sizes.

Is Adenosine Deaminase Antibody in stock?

Adenosine Deaminase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

All Products