Antithrombin-III Antibody — image 1 of 2

Product details

Antithrombin-III Antibody

Catalog number KC-709-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-709-01

Size / count 50 μL

Specifications

Catalog number: KC-709-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Antithrombin-III, ATIII, Serpin C1
Gene Name: SERPINC1
Gene ID: 462
UniProt: P01008
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINC1
Target: PP-722
Partner Proteins: Antithrombin-III; ATIII; Serpin C1
Clone: K49020_1G4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 38%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AT3
Target Alternative Name: Antithrombin-III
Host or Source: Mouse
Protein Name: Serpin family C member 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Antithrombin-III Antibody?

The catalog number for Antithrombin-III Antibody is KC-709.

What sizes are available for Antithrombin-III Antibody?

Antithrombin-III Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Antithrombin-III Antibody come in?

Antithrombin-III Antibody is available in 3 different pack sizes.

Is Antithrombin-III Antibody in stock?

Antithrombin-III Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.