Parvalbumin Antibody

Catalog number KC-1753-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1753-01

Size / count 50 μL

Specifications

Catalog number: KC-1753-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Parvalbumin alpha
Gene Name: PVALB
Gene ID: 5816
UniProt: P20472
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PVALB
Target: PP-215
Partner Proteins: Parvalbumin alpha
Clone: K49020_4D11
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Parvalbumin
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Parvalbumin
IHC description: Succeed
IP description: Fail (Rat Skeletal Muscle)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Parvalbumin Antibody?

The catalog number for Parvalbumin Antibody is KC-1753.

What sizes are available for Parvalbumin Antibody?

Parvalbumin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Parvalbumin Antibody come in?

Parvalbumin Antibody is available in 3 different pack sizes.

Is Parvalbumin Antibody in stock?

Parvalbumin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.