Antithrombin-III Antibody

Catalog number KC-710-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-710-01

Size / count 50 μL

Specifications

Catalog number: KC-710-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Antithrombin-III, ATIII, Serpin C1
Gene Name: SERPINC1
Gene ID: 462
UniProt: P01008
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINC1
Target: PP-722
Partner Proteins: Antithrombin-III; ATIII; Serpin C1
Clone: K49020_6A1
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 38%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AT3
Target Alternative Name: Antithrombin-III
Host or Source: Mouse
Protein Name: Serpin family C member 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Antithrombin-III Antibody?

The catalog number for Antithrombin-III Antibody is KC-710.

What sizes are available for Antithrombin-III Antibody?

Antithrombin-III Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Antithrombin-III Antibody come in?

Antithrombin-III Antibody is available in 3 different pack sizes.

Is Antithrombin-III Antibody in stock?

Antithrombin-III Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

All Products