Antithrombin-III Antibody

Catalog number KC-1547-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1547-01

Size / count 50 μL

Specifications

Catalog number: KC-1547-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Antithrombin-III, ATIII, Serpin C1
Gene Name: SERPINC1
Gene ID: 462
UniProt: P01008
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINC1
Target: PP-722
Partner Proteins: Antithrombin-III; ATIII; Serpin C1
Clone: K49020_8D9
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 38%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AT3
Target Alternative Name: Antithrombin-III
Host or Source: Mouse
Protein Name: Serpin family C member 1
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Antithrombin-III Antibody?

The catalog number for Antithrombin-III Antibody is KC-1547.

What sizes are available for Antithrombin-III Antibody?

Antithrombin-III Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Antithrombin-III Antibody come in?

Antithrombin-III Antibody is available in 3 different pack sizes.

Is Antithrombin-III Antibody in stock?

Antithrombin-III Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.