Thyroid Transcription Factor 1 Antibody

Catalog number KC-600-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-600-01

Size / count 50 μL

Specifications

Catalog number: KC-600-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Homeobox protein Nkx-2.1, Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1, TTF-1, Thyroid-specific enhancer-binding protein, T/EBP
Gene Name: NKX2-1
Gene ID: 7080
UniProt: P43699
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NKX2-1
Target: P60330PA
Partner Proteins: Homeobox protein Nkx-2.1; Homeobox protein NK-2 homolog A; Thyroid nuclear factor 1; Thyroid transcription factor 1; TTF-1; Thyroid-specific enhancer-binding protein; T/EBP
Clone: K52012_1D6
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NKX2A; TITF1; TTF1
Target Alternative Name: Thyroid Transcription Factor 1
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: NK2 homeobox 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Thyroid Transcription Factor 1 Antibody?

The catalog number for Thyroid Transcription Factor 1 Antibody is KC-600.

What sizes are available for Thyroid Transcription Factor 1 Antibody?

Thyroid Transcription Factor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Thyroid Transcription Factor 1 Antibody come in?

Thyroid Transcription Factor 1 Antibody is available in 3 different pack sizes.

Is Thyroid Transcription Factor 1 Antibody in stock?

Thyroid Transcription Factor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.