Thyroid Transcription Factor 1 Antibody

Catalog number KC-601-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-601-01

Size / count 50 μL

Specifications

Catalog number: KC-601-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Homeobox protein Nkx-2.1, Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1, TTF-1, Thyroid-specific enhancer-binding protein, T/EBP
Gene Name: NKX2-1
Gene ID: 7080
UniProt: P43699
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NKX2-1
Target: P60330PA
Partner Proteins: Homeobox protein Nkx-2.1; Homeobox protein NK-2 homolog A; Thyroid nuclear factor 1; Thyroid transcription factor 1; TTF-1; Thyroid-specific enhancer-binding protein; T/EBP
Clone: K52012_4E5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NKX2A; TITF1; TTF1
Target Alternative Name: Thyroid Transcription Factor 1
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: NK2 homeobox 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Thyroid Transcription Factor 1 Antibody?

The catalog number for Thyroid Transcription Factor 1 Antibody is KC-601.

What sizes are available for Thyroid Transcription Factor 1 Antibody?

Thyroid Transcription Factor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Thyroid Transcription Factor 1 Antibody come in?

Thyroid Transcription Factor 1 Antibody is available in 3 different pack sizes.

Is Thyroid Transcription Factor 1 Antibody in stock?

Thyroid Transcription Factor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products