SPP1 Antibody (HRP)

Catalog number KH-3015-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3015-01

Size / count 50 μL

Specifications

Catalog number: KH-3015-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Osteopontin, Bone sialoprotein 1, Nephropontin, Secreted phosphoprotein 1, SPP-1, Urinary stone protein, Uropontin
Gene Name: SPP1
Gene ID: 6696
UniProt: P10451
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SPP1
Target: PP-152
Partner Proteins: Osteopontin; Bone sialoprotein 1; Nephropontin; Secreted phosphoprotein 1; SPP-1; Urinary stone protein; Uropontin
Clone: K52025_4B11
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 54%, Pig - 65%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: DDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: BNSP; OPN
Target Alternative Name: SPP1
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Secreted phosphoprotein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for SPP1 Antibody (HRP)?

The catalog number for SPP1 Antibody (HRP) is KH-3015.

What sizes are available for SPP1 Antibody (HRP)?

SPP1 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SPP1 Antibody (HRP) come in?

SPP1 Antibody (HRP) is available in 3 different pack sizes.

Is SPP1 Antibody (HRP) in stock?

SPP1 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products