Actin Regulatory Protein CAPG Antibody — image 1 of 2

Product details

Actin Regulatory Protein CAPG Antibody

Catalog number KC-1177-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-1177-01

Size / count 50 μL

Specifications

Catalog number: KC-1177-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Macrophage-capping protein, Actin regulatory protein CAP-G
Gene Name: CAPG
Gene ID: 822
UniProt: P40121
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPG
Target: PP-1092
Partner Proteins: Macrophage-capping protein; Actin regulatory protein CAP-G
Clone: K52030_2E1
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: RDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:500
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AFCP; MCP
Target Alternative Name: Actin Regulatory Protein CAPG
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Capping actin protein, gelsolin like
WB Description: Succeed
IHC description: Succeed
IP description: Fail (THP-1)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Actin Regulatory Protein CAPG Antibody?

The catalog number for Actin Regulatory Protein CAPG Antibody is KC-1177.

What sizes are available for Actin Regulatory Protein CAPG Antibody?

Actin Regulatory Protein CAPG Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Actin Regulatory Protein CAPG Antibody come in?

Actin Regulatory Protein CAPG Antibody is available in 3 different pack sizes.

Is Actin Regulatory Protein CAPG Antibody in stock?

Actin Regulatory Protein CAPG Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

All Products