CD134/OX40L Recepter Antibody

Catalog number KC-2989-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-2989-01

Size / count 50 μL

Specifications

Catalog number: KC-2989-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor receptor superfamily member 4, ACT35 antigen, OX40L receptor, TAX transcriptionally-activated glycoprotein 1 receptor, CD antigen CD134
Gene Name: TNFRSF4
Gene ID: 7293
UniProt: P43489
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFRSF4
Target Antigen: CD134
Target: PP-294
Partner Proteins: Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Clone: K52030_14D7
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 63%, Rat - 62%, Pig - 75%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 63%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TXGP1L
Target Alternative Name: CD134/OX40L Recepter
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: TNF receptor superfamily member 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD134/OX40L Recepter Antibody?

The catalog number for CD134/OX40L Recepter Antibody is KC-2989.

What sizes are available for CD134/OX40L Recepter Antibody?

CD134/OX40L Recepter Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD134/OX40L Recepter Antibody come in?

CD134/OX40L Recepter Antibody is available in 3 different pack sizes.

Is CD134/OX40L Recepter Antibody in stock?

CD134/OX40L Recepter Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products